Review



biological peptide synthesis  (Huabio Inc)

 
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 86
      Buy from Supplier

    Structured Review

    Huabio Inc biological peptide synthesis
    Biological Peptide Synthesis, supplied by Huabio Inc, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/biological+peptide+synthesis/biological+peptide+synthesis/pm41708643-287-29-13
    Average 86 stars, based on 1 article reviews
    biological peptide synthesis - by Bioz Stars, 2026-09
    86/100 stars

    Images

    Related Articles

    Sequencing:

    Article Title: Arginase 1 promotes hepatic lipogenesis by regulating ERK2/PPARγ signaling in a non-canonical manner
    Article Snippet: .. Peptides were obtained through Chemical Peptide Synthesis or Biological Peptide Synthesis (HUABIO, China). (1) Sequence of Chemical Peptide Synthesis: 170-200: RVADPDHDHTGFLTEYVATRWYRAPEIMLNS, and the purity is greater than 85%; (2) Biological Peptide Synthesis: recombinant synthesis involves the expression of the peptide within a specialized system from an artificial gene. ..

    Article Title: Arginase 1 promotes hepatic lipogenesis by regulating ERK2/PPARγ signaling in a non-canonical manner.
    Article Snippet: .. Peptide-drug synthesis Peptides were obtained through Chemical Peptide Synthesis or Biological Peptide Synthesis (HUABIO, China). (1) Sequence of Chemical Peptide Synthesis: 170-200:RVADPDHDHTGFLTEYVATRWYRAPEIMLNS, and the purity is greater than 85%;(2) Biological Peptide Synthesis: recombinant synthesis involves the expression of the peptide within a specialized system from an AR TI CL E IN P RE SS artificial gene. ..

    Recombinant:

    Article Title: Arginase 1 promotes hepatic lipogenesis by regulating ERK2/PPARγ signaling in a non-canonical manner
    Article Snippet: .. Peptides were obtained through Chemical Peptide Synthesis or Biological Peptide Synthesis (HUABIO, China). (1) Sequence of Chemical Peptide Synthesis: 170-200: RVADPDHDHTGFLTEYVATRWYRAPEIMLNS, and the purity is greater than 85%; (2) Biological Peptide Synthesis: recombinant synthesis involves the expression of the peptide within a specialized system from an artificial gene. ..

    Article Title: Arginase 1 promotes hepatic lipogenesis by regulating ERK2/PPARγ signaling in a non-canonical manner.
    Article Snippet: .. Peptide-drug synthesis Peptides were obtained through Chemical Peptide Synthesis or Biological Peptide Synthesis (HUABIO, China). (1) Sequence of Chemical Peptide Synthesis: 170-200:RVADPDHDHTGFLTEYVATRWYRAPEIMLNS, and the purity is greater than 85%;(2) Biological Peptide Synthesis: recombinant synthesis involves the expression of the peptide within a specialized system from an AR TI CL E IN P RE SS artificial gene. ..

    Expressing:

    Article Title: Arginase 1 promotes hepatic lipogenesis by regulating ERK2/PPARγ signaling in a non-canonical manner
    Article Snippet: .. Peptides were obtained through Chemical Peptide Synthesis or Biological Peptide Synthesis (HUABIO, China). (1) Sequence of Chemical Peptide Synthesis: 170-200: RVADPDHDHTGFLTEYVATRWYRAPEIMLNS, and the purity is greater than 85%; (2) Biological Peptide Synthesis: recombinant synthesis involves the expression of the peptide within a specialized system from an artificial gene. ..

    Article Title: Arginase 1 promotes hepatic lipogenesis by regulating ERK2/PPARγ signaling in a non-canonical manner.
    Article Snippet: .. Peptide-drug synthesis Peptides were obtained through Chemical Peptide Synthesis or Biological Peptide Synthesis (HUABIO, China). (1) Sequence of Chemical Peptide Synthesis: 170-200:RVADPDHDHTGFLTEYVATRWYRAPEIMLNS, and the purity is greater than 85%;(2) Biological Peptide Synthesis: recombinant synthesis involves the expression of the peptide within a specialized system from an AR TI CL E IN P RE SS artificial gene. ..



    Similar Products

    biological peptide synthesis  (Huabio Inc)
    86
    Huabio Inc biological peptide synthesis
    Biological Peptide Synthesis, supplied by Huabio Inc, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/biological+peptide+synthesis/biological+peptide+synthesis/pm41708643-287-29-13
    Average 86 stars, based on 1 article reviews
    biological peptide synthesis - by Bioz Stars, 2026-09
    86/100 stars
    		  Buy from Supplier
    p 300 synthesis, conformation and biological activity of dermorphin and deltorphin i peptide-peptoid hybrids  (Mortara Instrument)
    90
    Mortara Instrument p 300 synthesis, conformation and biological activity of dermorphin and deltorphin i peptide-peptoid hybrids
    P 300 Synthesis, Conformation And Biological Activity Of Dermorphin And Deltorphin I Peptide Peptoid Hybrids, supplied by Mortara Instrument, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/biological+peptide+synthesis/p+300+synthesis++conformation+and+biological+activity+of+dermorphin+and+deltorphin+i+peptide+peptoid+hybrids/10__1002_slash_bip__10456-1663-10-83
    Average 90 stars, based on 1 article reviews
    p 300 synthesis, conformation and biological activity of dermorphin and deltorphin i peptide-peptoid hybrids - by Bioz Stars, 2026-09
    90/100 stars
    		  Buy from Supplier

    Image Search Results